PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000568.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 158aa    MW: 17809.2 Da    PI: 4.4684
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000568.1_g00007.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.81.4e-231199391
                    NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkky 90
                             ++d+ lP a +++i+k++lP + ++++d+++++ ec +efi +++se+++ c+re+++ti+++ +l al  lGf dy+e++    +++
  Itr_sc000568.1_g00007.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDCQDLLIECCVEFINLISSESNEVCNREDKRTIAPEHVLKALDVLGFGDYIEEVYSAYEQH 98
                             6899***************************************************************************987666655 PP

                    NF-YB 91 r 91
                             r
  Itr_sc000568.1_g00007.1 99 R 99
                             5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.104.0E-389140IPR009072Histone-fold
SuperFamilySSF471138.06E-3512142IPR009072Histone-fold
PfamPF008081.7E-201479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MEPMDIVGRT KEDASLPKAT MTKIIKEMLP PDVRVARDCQ DLLIECCVEF INLISSESNE  60
VCNREDKRTI APEHVLKALD VLGFGDYIEE VYSAYEQHRL ETMDTVRAGK LSNGAEMTEE  120
EALAAQQRMF AEARARMNNG ITVPKQPNPE PEQHNTNS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B4e-341213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012832678.12e-96PREDICTED: protein Dr1 homolog
RefseqXP_016555943.12e-96PREDICTED: protein Dr1 homolog
SwissprotP495929e-90NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A022RMH62e-96A0A022RMH6_ERYGU; Uncharacterized protein
TrEMBLA0A068TQ893e-96A0A068TQ89_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000104369e-96(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38202244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.49e-93nuclear factor Y, subunit B13